PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006313P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 316aa    MW: 34090.7 Da    PI: 6.4039
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C006313P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.92.6e-3450104155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  MELO3C006313P1  50 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 104
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.94447107IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-3347105IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1750107IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-2450105IPR006447Myb domain, plants
PfamPF002499.8E-952103IPR001005SANT/Myb domain
PfamPF143791.0E-26147193IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MLSGFSQEPA GMYSAIPALP MDGGGGKFQG SLDGTNLPGD ACLVLTSDPK PRLRWTAELH  60
ERFVDAVTQL GGPDKATPKT IMRTMGVKGL TLYHLKSHLQ KYRLGKQSFK ESTENSKDAS  120
CIAESQETSS SSSPSSRIMA QDLNDGFQVT EALRVQMEVQ RRLHEQLEVQ RHLQLRIEAQ  180
GKYLQSILER ACQALSDQAA ASAGLEAARE ELSELAIKVS NDSKEMAPLE TQKVLPFSEL  240
AAALENRKAP TVMPRIGDCS MDSCLTSAGS PVSPIGVGST ATAMKRPRPV FSHGDSMALE  300
GNARHDVEWM MSNIG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1284288KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008438354.10.0PREDICTED: myb family transcription factor APL isoform X1
SwissprotQ9SAK52e-70APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0A0L4350.0A0A0A0L435_CUCSA; Uncharacterized protein
STRINGVIT_05s0029g00060.t011e-161(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133672126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-116G2-like family protein